Recombinant Human RNASE4 Protein (29-147 aa), His-sumostar-tagged

• Cat.No.: RNASE4-2552H
• Product Overview: Recombinant Human RNASE4 Protein (29-147 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His&SUMO
• Protein Length: 29-147 aa
• Description: This RNase has marked specificity towards the 3' side of uridine nucleotides.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 29.8 kDa
• AA Sequence: QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: RNASE4 ribonuclease A family member 4 [ Homo sapiens (human) ]
• Official Symbol: RNASE4
• Synonyms: RNASE4; RAB1; RNS4
• Gene ID: 6038
• mRNA Refseq: NM_001282192
• Protein Refseq: NP_001269121
• UniProt ID: P34096