Recombinant Human RNASE4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RNASE4-3580H |
| Product Overview : | RNASE4 MS Standard C13 and N15-labeled recombinant protein (NP_919412) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene belongs to the pancreatic ribonuclease family. It plays an important role in mRNA cleavage and has marked specificity towards the 3' side of uridine nucleotides. Alternative splicing results in four transcript variants encoding the same protein. This gene and the gene that encodes angiogenin share promoters and 5' exons. Each gene splices to a unique downstream exon that contains its complete coding region. |
| Molecular Mass : | 13.8 kDa |
| AA Sequence : | MALQRTHSLLLLLLLSLLGLGLVQPSYGQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RNASE4 ribonuclease A family member 4 [ Homo sapiens (human) ] |
| Official Symbol | RNASE4 |
| Synonyms | RNASE4; ribonuclease A family member 4; RAB1; RNS4; ribonuclease 4; RNase 4; epididymis secretory sperm binding protein; ribonuclease A B1; ribonuclease, RNase A family, 4; EC 3.1.27.- |
| Gene ID | 6038 |
| mRNA Refseq | NM_194431 |
| Protein Refseq | NP_919412 |
| MIM | 601030 |
| UniProt ID | P34096 |
| ◆ Recombinant Proteins | ||
| RNASE4-7921H | Recombinant Human RNASE4 protein, His-tagged | +Inquiry |
| RNASE4-3910R | Recombinant Rhesus monkey RNASE4 Protein, His-tagged | +Inquiry |
| RNASE4-2552H | Recombinant Human RNASE4 Protein (29-147 aa), His-sumostar-tagged | +Inquiry |
| Rnase4-5535M | Recombinant Full Length Mouse Rnase4 Protein, Myc/DDK-tagged | +Inquiry |
| RNASE4-3434H | Recombinant Human RNASE4 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNASE4-2319HCL | Recombinant Human RNASE4 293 Cell Lysate | +Inquiry |
| RNASE4-2318HCL | Recombinant Human RNASE4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE4 Products
Required fields are marked with *
My Review for All RNASE4 Products
Required fields are marked with *
