Recombinant Human RNASE4 protein, His&Myc-tagged
| Cat.No. : | RNASE4-3434H |
| Product Overview : | Recombinant Human RNASE4 protein(P34096)(29-147aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 29-147aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.8 kDa |
| AA Sequence : | QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| RNASE4-2552H | Recombinant Human RNASE4 Protein (29-147 aa), His-sumostar-tagged | +Inquiry |
| RNASE4-3727R | Recombinant Rhesus Macaque RNASE4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Rnase4-5535M | Recombinant Full Length Mouse Rnase4 Protein, Myc/DDK-tagged | +Inquiry |
| RNASE4-7921H | Recombinant Human RNASE4 protein, His-tagged | +Inquiry |
| RNASE4-4721R | Recombinant Rat RNASE4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNASE4-2318HCL | Recombinant Human RNASE4 293 Cell Lysate | +Inquiry |
| RNASE4-2319HCL | Recombinant Human RNASE4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE4 Products
Required fields are marked with *
My Review for All RNASE4 Products
Required fields are marked with *




