Recombinant Human RND2 protein, MBP-His-tagged

Cat.No. : RND2-21H
Product Overview : Recombinant Human RND2 protein(P52198)(Asn111-Arg220), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His&MBP
Protein Length : Asn111-Arg220
Tag : N-MBP & C-His
Form : Phosphate buffered saline
Molecular Mass : 55 kDa
Storage : Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : NAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDR
Gene Name RND2 Rho family GTPase 2 [ Homo sapiens ]
Official Symbol RND2
Synonyms RND2; Rho family GTPase 2; ARHN, ras homolog gene family, member N; rho-related GTP-binding protein RhoN; Rho7; RhoN; GTP-binding protein Rho7; ras homolog gene family, member N; rho-related GTP-binding protein Rho7; ARHN; RHO7;
Gene ID 8153
mRNA Refseq NM_005440
Protein Refseq NP_005431
MIM 601555
UniProt ID P52198

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RND2 Products

Required fields are marked with *

My Review for All RND2 Products

Required fields are marked with *

0
cart-icon
0
compare icon