Recombinant Human RND2 protein, MBP-His-tagged
Cat.No. : | RND2-21H |
Product Overview : | Recombinant Human RND2 protein(P52198)(Asn111-Arg220), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&MBP |
Protein Length : | Asn111-Arg220 |
Tag : | N-MBP & C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 55 kDa |
Storage : | Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | NAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDR |
Gene Name | RND2 Rho family GTPase 2 [ Homo sapiens ] |
Official Symbol | RND2 |
Synonyms | RND2; Rho family GTPase 2; ARHN, ras homolog gene family, member N; rho-related GTP-binding protein RhoN; Rho7; RhoN; GTP-binding protein Rho7; ras homolog gene family, member N; rho-related GTP-binding protein Rho7; ARHN; RHO7; |
Gene ID | 8153 |
mRNA Refseq | NM_005440 |
Protein Refseq | NP_005431 |
MIM | 601555 |
UniProt ID | P52198 |
◆ Recombinant Proteins | ||
RND2-3735R | Recombinant Rhesus Macaque RND2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RND2-21H | Recombinant Human RND2 protein, MBP-His-tagged | +Inquiry |
Rnd2-647M | Recombinant Mouse Rnd2 Protein, MYC/DDK-tagged | +Inquiry |
RND2-4545C | Recombinant Chicken RND2 | +Inquiry |
RND2-4341Z | Recombinant Zebrafish RND2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RND2-2313HCL | Recombinant Human RND2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RND2 Products
Required fields are marked with *
My Review for All RND2 Products
Required fields are marked with *
0
Inquiry Basket