| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
DDK&Myc |
| Description : |
The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. |
| Molecular Mass : |
53.8 kDa |
| AA Sequence : |
Tags(s)XCRQKIEKLRRMNCWPWQVFTMEMNLEKQSLSKVEKPGSIWICHRISRYL*AAIQMSVSRIVALNTPFAFCLHLC*TLNCHQIIHPLPHLHSHLVANGCHQLSYLLYAST*TTYGKNTVAAWSCLPGCNFLRKRP*HT*ILSLLLSSRLVLRKKCREGQLKLLPTQS*ILEELLDLM*TKRKLWMREQCRMWNHCQI*SRKSWTLIKLSR*NALIVNCSCAVSVSVRSWVVNACTSWSAGMCTAKPV*RTTLKSRSEMARFNASTAQNQSALRWPLLVRSKS*WKQSYLPVMTAFSSSPPWT*WQMWCTAPGRAASCL*CRNLAAPWVSAPAAILPSVLCAG*PTMGSPHVR*LQRN*WTYEMNTCKRMRLIKDFWIKGMVRE*FRRHWKRWKVRSG*RRTQRAAHVVELP*RN*TDVTR*HVLAVCNISVGFAWVLSLEQTLTNISMTLVHHVLTGCFMLWMLTTIFGKMR*KTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : |
> 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : |
Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : |
Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : |
50 μg/mL as determined by BCA |
| Storage Buffer : |
100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
