Recombinant Human RNF144B protein, His-tagged
| Cat.No. : | RNF144B-7686H |
| Product Overview : | Recombinant Human RNF144B protein(123-187 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 123-187 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | VADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAE |
| Purity : | 65%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | RNF144B ring finger protein 144B [ Homo sapiens ] |
| Official Symbol | RNF144B |
| Synonyms | RNF144B; ring finger protein 144B; IBR domain containing 2 , IBRDC2; E3 ubiquitin-protein ligase RNF144B; bA528A10.3; IBR domain containing 2; IBR domain-containing protein 2; p53-inducible RING finger protein; PIR2; IBRDC2; p53RFP; KIAA0161; MGC71786; |
| mRNA Refseq | NM_182757 |
| Protein Refseq | NP_877434 |
| UniProt ID | Q7Z419 |
| Gene ID | 255488 |
| ◆ Recombinant Proteins | ||
| RNF144B-013H | Recombinant Human RNF144B protein, Gst-His-tagged | +Inquiry |
| RNF144B-7686H | Recombinant Human RNF144B protein, His-tagged | +Inquiry |
| RNF144B-7685H | Recombinant Human RNF144B protein, GST-tagged | +Inquiry |
| RNF144B-14306M | Recombinant Mouse RNF144B Protein | +Inquiry |
| RNF144B-683H | Recombinant Human RNF144B Protein, GST/His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNF144B-2293HCL | Recombinant Human RNF144B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF144B Products
Required fields are marked with *
My Review for All RNF144B Products
Required fields are marked with *
