Recombinant Full Length Bovine E3 Ubiquitin-Protein Ligase Rnf144B(Rnf144B) Protein, His-Tagged
Cat.No. : | RFL3160BF |
Product Overview : | Recombinant Full Length Bovine E3 ubiquitin-protein ligase RNF144B(RNF144B) Protein (A5PK27) (1-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-304) |
Form : | Lyophilized powder |
AA Sequence : | MGSVGRLHCLTMTAAENPTPGDLALVPLVTCKLCLCEQSLDKMTTLQECRCIFCTACLKQ YMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPCRT WCPVADCQTVCPVATSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPGILPTEHG TLFGTETDAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDRGP CRNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHD PSTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RNF144B |
Synonyms | RNF144B; E3 ubiquitin-protein ligase RNF144B; RING finger protein 144B |
UniProt ID | A5PK27 |
◆ Recombinant Proteins | ||
RNF144B-3932R | Recombinant Rhesus monkey RNF144B Protein, His-tagged | +Inquiry |
RNF144B-14306M | Recombinant Mouse RNF144B Protein | +Inquiry |
RNF144B-683H | Recombinant Human RNF144B Protein, GST/His-tagged | +Inquiry |
RNF144B-7686H | Recombinant Human RNF144B protein, His-tagged | +Inquiry |
RFL3160BF | Recombinant Full Length Bovine E3 Ubiquitin-Protein Ligase Rnf144B(Rnf144B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF144B-2293HCL | Recombinant Human RNF144B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF144B Products
Required fields are marked with *
My Review for All RNF144B Products
Required fields are marked with *
0
Inquiry Basket