Recombinant Human RNF2 protein, T7/His-tagged RNF2-158H

Recombinant Human RNF2 protein, T7/His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human RNF2 protein, T7/His-tagged

Recombinant Human RNF2 protein, T7/His-tagged

RNF2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : RNF2-158H
Product Overview : Recombinant human RNF2 cDNA (336aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7/His
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHS ELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEA HQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRT KTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEEL RSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name : RNF2 ring finger protein 2 [ Homo sapiens ]
Official Symbol : RNF2
Synonyms : RNF2; ring finger protein 2; E3 ubiquitin-protein ligase RING2; BAP 1; BAP1; DING; HIPI3; RING1B; RING2; protein DinG; RING finger protein 1B; RING finger protein BAP-1; HIP2-interacting protein 3; huntingtin-interacting protein 2-interacting protein 3; BAP-1;
Gene ID : 6045
mRNA Refseq : NM_007212
Protein Refseq : NP_009143
MIM : 608985
UniProt ID : Q99496
Chromosome Location : 1q25.3
Function : RING-like zinc finger domain binding; chromatin binding; ligase activity; metal ion binding; protein binding; contributes_to ubiquitin-protein ligase activity; zinc ion binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy