Recombinant Human RNF2 protein, T7/His-tagged
Cat.No. : | RNF2-158H |
Product Overview : | Recombinant human RNF2 cDNA (336aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHS ELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEA HQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRT KTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEEL RSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | RNF2 ring finger protein 2 [ Homo sapiens ] |
Official Symbol | RNF2 |
Synonyms | RNF2; ring finger protein 2; E3 ubiquitin-protein ligase RING2; BAP 1; BAP1; DING; HIPI3; RING1B; RING2; protein DinG; RING finger protein 1B; RING finger protein BAP-1; HIP2-interacting protein 3; huntingtin-interacting protein 2-interacting protein 3; BAP-1; |
Gene ID | 6045 |
mRNA Refseq | NM_007212 |
Protein Refseq | NP_009143 |
MIM | 608985 |
UniProt ID | Q99496 |
Chromosome Location | 1q25.3 |
Function | RING-like zinc finger domain binding; chromatin binding; ligase activity; metal ion binding; protein binding; contributes_to ubiquitin-protein ligase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
RNF2-4739R | Recombinant Rat RNF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF2-5035H | Recombinant Human RNF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RNF2-8814Z | Recombinant Zebrafish RNF2 | +Inquiry |
RNF2-695H | Recombinant Human RNF2 Protein, MYC/DDK-tagged | +Inquiry |
RNF2-941HFL | Recombinant Full Length Human RNF2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF2-2284HCL | Recombinant Human RNF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF2 Products
Required fields are marked with *
My Review for All RNF2 Products
Required fields are marked with *
0
Inquiry Basket