Recombinant Human RNF41 protein, T7/His-tagged

Cat.No. : RNF41-169H
Product Overview : Recombinant human NRDP1 cDNA (316 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWF SQQQTCPVDRSVVTVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGL EMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYN EILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYY ENYVAKRIPGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name RNF41 ring finger protein 41 [ Homo sapiens ]
Official Symbol RNF41
Synonyms RNF41; ring finger protein 41; E3 ubiquitin-protein ligase NRDP1; SBBI03; fetal liver ring finger; neuregulin receptor degradation protein-1; FLRF; NRDP1; MGC45228;
Gene ID 10193
mRNA Refseq NM_001242826
Protein Refseq NP_001229755
MIM
UniProt ID Q9H4P4
Chromosome Location 12q13.13
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Downregulation of ERRB2:ERBB3 signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem;
Function acid-amino acid ligase activity; ligase activity; metal ion binding; protein binding; protein tag; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF41 Products

Required fields are marked with *

My Review for All RNF41 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon