Recombinant Human RNF41 protein, T7/His-tagged
Cat.No. : | RNF41-169H |
Product Overview : | Recombinant human NRDP1 cDNA (316 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWF SQQQTCPVDRSVVTVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGL EMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYN EILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYY ENYVAKRIPGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | RNF41 ring finger protein 41 [ Homo sapiens ] |
Official Symbol | RNF41 |
Synonyms | RNF41; ring finger protein 41; E3 ubiquitin-protein ligase NRDP1; SBBI03; fetal liver ring finger; neuregulin receptor degradation protein-1; FLRF; NRDP1; MGC45228; |
Gene ID | 10193 |
mRNA Refseq | NM_001242826 |
Protein Refseq | NP_001229755 |
MIM | |
UniProt ID | Q9H4P4 |
Chromosome Location | 12q13.13 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Downregulation of ERRB2:ERBB3 signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; |
Function | acid-amino acid ligase activity; ligase activity; metal ion binding; protein binding; protein tag; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
RNF41-672H | Recombinant Human RNF41 Protein, His-tagged | +Inquiry |
RNF41-7687M | Recombinant Mouse RNF41 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF41-12675Z | Recombinant Zebrafish RNF41 | +Inquiry |
RNF41-3945R | Recombinant Rhesus monkey RNF41 Protein, His-tagged | +Inquiry |
RNF41-1766H | Recombinant Human RNF41 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF41-2274HCL | Recombinant Human RNF41 293 Cell Lysate | +Inquiry |
RNF41-2273HCL | Recombinant Human RNF41 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF41 Products
Required fields are marked with *
My Review for All RNF41 Products
Required fields are marked with *