Recombinant Human RNF7 Protein (2-113 aa), His-tagged
Cat.No. : | RNF7-1506H |
Product Overview : | Recombinant Human RNF7 Protein (2-113 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-113 aa |
Description : | Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, ses to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.6 kDa |
AA Sequence : | ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | RNF7 ring finger protein 7 [ Homo sapiens ] |
Official Symbol | RNF7 |
Synonyms | RNF7; ring finger protein 7; RING-box protein 2; CKBBP1; ROC2; SAG; rbx2; |
Gene ID | 9616 |
mRNA Refseq | NM_001201370 |
Protein Refseq | NP_001188299 |
MIM | 603863 |
UniProt ID | Q9UBF6 |
◆ Recombinant Proteins | ||
RNF7-2963C | Recombinant Chicken RNF7 | +Inquiry |
Rnf7-5560M | Recombinant Mouse Rnf7 Protein, Myc/DDK-tagged | +Inquiry |
RNF7-7690M | Recombinant Mouse RNF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF7-14354M | Recombinant Mouse RNF7 Protein | +Inquiry |
RNF7-3764R | Recombinant Rhesus Macaque RNF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF7-2272HCL | Recombinant Human RNF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF7 Products
Required fields are marked with *
My Review for All RNF7 Products
Required fields are marked with *
0
Inquiry Basket