Recombinant Human RNFT1 Protein, GST-tagged

Cat.No. : RNFT1-4775H
Product Overview : Human LOC51136 full-length ORF ( AAH06971.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RNFT1 (Ring Finger Protein, Transmembrane 1) is a Protein Coding gene. Diseases associated with RNFT1 include Sertoli Cell-Only Syndrome. An important paralog of this gene is RNFT2.
Molecular Mass : 49.6 kDa
AA Sequence : MQANRSQLHSPPGTGSSEDASTPQCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHGSSSFSEFRYLFKWLQKSLPYILILSVKLVMQHITGISLGIGLLTTFMYANKSIVNQVFLRLNFFKSYFGPFELLGSILDCWNYRLHSEILFHGLKMPYFIGAFFHHAF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RNFT1 ring finger protein, transmembrane 1 [ Homo sapiens ]
Official Symbol RNFT1
Synonyms RNFT1; ring finger protein, transmembrane 1; RING finger and transmembrane domain-containing protein 1; PTD016; MGC111090;
Gene ID 51136
mRNA Refseq NM_016125
Protein Refseq NP_057209
UniProt ID Q5M7Z0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNFT1 Products

Required fields are marked with *

My Review for All RNFT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon