Recombinant Human RNFT1 Protein, GST-tagged
| Cat.No. : | RNFT1-4775H |
| Product Overview : | Human LOC51136 full-length ORF ( AAH06971.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | RNFT1 (Ring Finger Protein, Transmembrane 1) is a Protein Coding gene. Diseases associated with RNFT1 include Sertoli Cell-Only Syndrome. An important paralog of this gene is RNFT2. |
| Molecular Mass : | 49.6 kDa |
| AA Sequence : | MQANRSQLHSPPGTGSSEDASTPQCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHGSSSFSEFRYLFKWLQKSLPYILILSVKLVMQHITGISLGIGLLTTFMYANKSIVNQVFLRLNFFKSYFGPFELLGSILDCWNYRLHSEILFHGLKMPYFIGAFFHHAF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RNFT1 ring finger protein, transmembrane 1 [ Homo sapiens ] |
| Official Symbol | RNFT1 |
| Synonyms | RNFT1; ring finger protein, transmembrane 1; RING finger and transmembrane domain-containing protein 1; PTD016; MGC111090; |
| Gene ID | 51136 |
| mRNA Refseq | NM_016125 |
| Protein Refseq | NP_057209 |
| UniProt ID | Q5M7Z0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNFT1 Products
Required fields are marked with *
My Review for All RNFT1 Products
Required fields are marked with *
