Recombinant Human RNMT protein, GST-tagged
| Cat.No. : | RNMT-2351H |
| Product Overview : | Recombinant Human RNMT protein(128-476 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 128-476 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | KIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ |
| Purity : | 95%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | RNMT RNA (guanine-7-) methyltransferase [ Homo sapiens ] |
| Official Symbol | RNMT |
| Synonyms | RNMT; RNA (guanine-7-) methyltransferase; mRNA cap guanine-N7 methyltransferase; RG7MT1; hMet; hCMT1; hcm1p; mRNA cap methyltransferase; mRNA (guanine-7-)methyltransferase; mRNA (guanine-N(7)-)-methyltransferase; MET; hCMT1c; KIAA0398; DKFZp686H1252; |
| mRNA Refseq | NM_003799 |
| Protein Refseq | NP_003790 |
| MIM | 603514 |
| UniProt ID | O43148 |
| Gene ID | 8731 |
| ◆ Recombinant Proteins | ||
| RNMT-14360M | Recombinant Mouse RNMT Protein | +Inquiry |
| RNMT-5089R | Recombinant Rat RNMT Protein | +Inquiry |
| RNMT-863C | Recombinant Cynomolgus RNMT Protein, His-tagged | +Inquiry |
| RNMT-4748R | Recombinant Rat RNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| Rnmt-5562M | Recombinant Mouse Rnmt Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNMT-2262HCL | Recombinant Human RNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNMT Products
Required fields are marked with *
My Review for All RNMT Products
Required fields are marked with *
