Recombinant Human RNMT protein, His-tagged
| Cat.No. : | RNMT-3531H |
| Product Overview : | Recombinant Human RNMT protein(128-476 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 128-476 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | KIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RNMT RNA (guanine-7-) methyltransferase [ Homo sapiens ] |
| Official Symbol | RNMT |
| Synonyms | RNMT; RNA (guanine-7-) methyltransferase; mRNA cap guanine-N7 methyltransferase; RG7MT1; hMet; hCMT1; hcm1p; mRNA cap methyltransferase; mRNA (guanine-7-)methyltransferase; mRNA (guanine-N(7)-)-methyltransferase; MET; hCMT1c; KIAA0398; DKFZp686H1252; |
| Gene ID | 8731 |
| mRNA Refseq | NM_003799 |
| Protein Refseq | NP_003790 |
| MIM | 603514 |
| UniProt ID | O43148 |
| ◆ Recombinant Proteins | ||
| RNMT-4748R | Recombinant Rat RNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| RNMT-14360M | Recombinant Mouse RNMT Protein | +Inquiry |
| RNMT-4080Z | Recombinant Zebrafish RNMT | +Inquiry |
| RNMT-7696M | Recombinant Mouse RNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| RNMT-1054H | Recombinant Human RNMT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNMT-2262HCL | Recombinant Human RNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNMT Products
Required fields are marked with *
My Review for All RNMT Products
Required fields are marked with *
