Recombinant Human RNMT protein, His-tagged
Cat.No. : | RNMT-3531H |
Product Overview : | Recombinant Human RNMT protein(128-476 aa), fused to His tag, was expressed in E. coli. |
Availability | September 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 128-476 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RNMT RNA (guanine-7-) methyltransferase [ Homo sapiens ] |
Official Symbol | RNMT |
Synonyms | RNMT; RNA (guanine-7-) methyltransferase; mRNA cap guanine-N7 methyltransferase; RG7MT1; hMet; hCMT1; hcm1p; mRNA cap methyltransferase; mRNA (guanine-7-)methyltransferase; mRNA (guanine-N(7)-)-methyltransferase; MET; hCMT1c; KIAA0398; DKFZp686H1252; |
Gene ID | 8731 |
mRNA Refseq | NM_003799 |
Protein Refseq | NP_003790 |
MIM | 603514 |
UniProt ID | O43148 |
◆ Recombinant Proteins | ||
RNMT-863C | Recombinant Cynomolgus RNMT Protein, His-tagged | +Inquiry |
RNMT-1701C | Recombinant Canine RNMT protein, His-tagged | +Inquiry |
RNMT-606C | Recombinant Cynomolgus Monkey RNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
RNMT-7696M | Recombinant Mouse RNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
RNMT-4080Z | Recombinant Zebrafish RNMT | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNMT-2262HCL | Recombinant Human RNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNMT Products
Required fields are marked with *
My Review for All RNMT Products
Required fields are marked with *