Recombinant Human RNPS1 protein, T7-tagged

Cat.No. : RNPS1-179H
Product Overview : Recombinant human RNPS1 (305 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 305 a.a.
Form : 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRD KTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRR RSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEF ENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRR RSRSPGRRRHRSRSSSNSSR
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name RNPS1 RNA binding protein S1, serine-rich domain [ Homo sapiens ]
Official Symbol RNPS1
Synonyms RNPS1; SR protein; SR-related protein LDC2; RNA-binding protein S1, serine-rich domain; E5.1; MGC117332;
Gene ID 10921
mRNA Refseq NM_006711
Protein Refseq NP_006702
MIM 606447
UniProt ID Q15287
Chromosome Location 16p13.3
Pathway Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Exon junction complex (EJC), organism-specific biosystem; Gene Expression, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem; Nonsense-Mediated Decay, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; RNA Polymerase II Transcription, organism-specific biosystem;
Function RNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNPS1 Products

Required fields are marked with *

My Review for All RNPS1 Products

Required fields are marked with *

0
cart-icon