Recombinant Human RNPS1 protein, T7-tagged
| Cat.No. : | RNPS1-179H |
| Product Overview : | Recombinant human RNPS1 (305 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 305 a.a. |
| Form : | 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGEFMDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRD KTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRR RSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEF ENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRR RSRSPGRRRHRSRSSSNSSR |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | RNPS1 RNA binding protein S1, serine-rich domain [ Homo sapiens ] |
| Official Symbol | RNPS1 |
| Synonyms | RNPS1; SR protein; SR-related protein LDC2; RNA-binding protein S1, serine-rich domain; E5.1; MGC117332; |
| Gene ID | 10921 |
| mRNA Refseq | NM_006711 |
| Protein Refseq | NP_006702 |
| MIM | 606447 |
| UniProt ID | Q15287 |
| Chromosome Location | 16p13.3 |
| Pathway | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Exon junction complex (EJC), organism-specific biosystem; Gene Expression, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem; Nonsense-Mediated Decay, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; RNA Polymerase II Transcription, organism-specific biosystem; |
| Function | RNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNPS1 Products
Required fields are marked with *
My Review for All RNPS1 Products
Required fields are marked with *




