Recombinant Human RNPS1 protein, T7-tagged
Cat.No. : | RNPS1-179H |
Product Overview : | Recombinant human RNPS1 (305 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 305 a.a. |
Form : | 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRD KTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRR RSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEF ENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRR RSRSPGRRRHRSRSSSNSSR |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | RNPS1 RNA binding protein S1, serine-rich domain [ Homo sapiens ] |
Official Symbol | RNPS1 |
Synonyms | RNPS1; SR protein; SR-related protein LDC2; RNA-binding protein S1, serine-rich domain; E5.1; MGC117332; |
Gene ID | 10921 |
mRNA Refseq | NM_006711 |
Protein Refseq | NP_006702 |
MIM | 606447 |
UniProt ID | Q15287 |
Chromosome Location | 16p13.3 |
Pathway | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Exon junction complex (EJC), organism-specific biosystem; Gene Expression, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem; Nonsense-Mediated Decay, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; RNA Polymerase II Transcription, organism-specific biosystem; |
Function | RNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RNPS1-4750R | Recombinant Rat RNPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNPS1-7699M | Recombinant Mouse RNPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNPS1-179H | Recombinant Human RNPS1 protein, T7-tagged | +Inquiry |
RNPS1-10150Z | Recombinant Zebrafish RNPS1 | +Inquiry |
RNPS1-14365M | Recombinant Mouse RNPS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNPS1-2259HCL | Recombinant Human RNPS1 293 Cell Lysate | +Inquiry |
RNPS1-2258HCL | Recombinant Human RNPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNPS1 Products
Required fields are marked with *
My Review for All RNPS1 Products
Required fields are marked with *