Recombinant Human ROCK2 Protein, GST-Tagged
Cat.No. : | ROCK2-337H |
Product Overview : | Recombinant Human ROCK2 protein(NP_001308572.1)(1-181 aa), fused to GST-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-181 aa |
Description : | The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Bio-activity : | Not tested. |
AA Sequence : | MEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQL |
Endotoxin : | Please contact the lab for more information. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | ROCK2 Rho associated coiled-coil containing protein kinase 2 [ Homo sapiens (human) ] |
Official Symbol | ROCK2 |
Synonyms | KIAA0619 |
Gene ID | 9475 |
mRNA Refseq | NM_001321643.2 |
Protein Refseq | NP_001308572.1 |
MIM | 604002 |
UniProt ID | O75116 |
◆ Recombinant Proteins | ||
ROCK2-337H | Recombinant Human ROCK2 Protein, GST-Tagged | +Inquiry |
ROCK2-421H | Recombinant Human ROCK2, GST-tagged, Active | +Inquiry |
ROCK2-1879H | Active Recombinant Human ROCK2 Protein, His-tagged | +Inquiry |
ROCK2-9069HFL | Recombinant Full Length Human ROCK2 protein, Flag-tagged | +Inquiry |
ROCK2-26H | Active Recombinant Human ROCK2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ROCK2-2255HCL | Recombinant Human ROCK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROCK2 Products
Required fields are marked with *
My Review for All ROCK2 Products
Required fields are marked with *