Recombinant Human ROMO1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ROMO1-2578H |
Product Overview : | ROMO1 MS Standard C13 and N15-labeled recombinant protein (NP_542786) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. |
Molecular Mass : | 8.2 kDa |
AA Sequence : | MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ROMO1 reactive oxygen species modulator 1 [ Homo sapiens (human) ] |
Official Symbol | ROMO1 |
Synonyms | ROMO1; reactive oxygen species modulator 1; MTGM; MTGMP; C20orf52; bA353C18.2; reactive oxygen species modulator 1; PCM19; ROS modulator 1; epididymis tissue protein Li 175; glyrichin; mitochondrial targeting GXXXG protein; mitochondrial targeting GxxxG motif protein; protein MGR2 homolog |
Gene ID | 140823 |
mRNA Refseq | NM_080748 |
Protein Refseq | NP_542786 |
MIM | 618894 |
UniProt ID | P60602 |
◆ Cell & Tissue Lysates | ||
ROMO1-2252HCL | Recombinant Human ROMO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROMO1 Products
Required fields are marked with *
My Review for All ROMO1 Products
Required fields are marked with *
0
Inquiry Basket