Recombinant Human ROMO1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ROMO1-2578H
• Product Overview: ROMO1 MS Standard C13 and N15-labeled recombinant protein (NP_542786) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage.
• Molecular Mass: 8.2 kDa
• AA Sequence: MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ROMO1 reactive oxygen species modulator 1 [ Homo sapiens (human) ]
• Official Symbol: ROMO1
• Synonyms: ROMO1; reactive oxygen species modulator 1; MTGM; MTGMP; C20orf52; bA353C18.2; reactive oxygen species modulator 1; PCM19; ROS modulator 1; epididymis tissue protein Li 175; glyrichin; mitochondrial targeting GXXXG protein; mitochondrial targeting GxxxG motif protein; protein MGR2 homolog
• Gene ID: 140823
• mRNA Refseq: NM_080748
• Protein Refseq: NP_542786
• MIM: 618894
• UniProt ID: P60602