Recombinant Human ROR1 protein, His-tagged
Cat.No. : | ROR1-3437H |
Product Overview : | Recombinant Human ROR1 protein(Q01973)(30-391aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 30-391aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.6 kDa |
AA Sequence : | QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ] |
Official Symbol | ROR1 |
Synonyms | ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1; neurotrophic tyrosine kinase receptor-related 1; neurotrophic tyrosine kinase, receptor-related 1; dJ537F10.1; MGC99659; |
Gene ID | 4919 |
mRNA Refseq | NM_001083592 |
Protein Refseq | NP_001077061 |
MIM | 602336 |
UniProt ID | Q01973 |
◆ Recombinant Proteins | ||
ROR1-387HP | Recombinant Human ROR1 protein, Fc-tagged, R-PE labeled | +Inquiry |
ROR1-425H | Recombinant Full Length Human ROR1 Protein, His-tagged | +Inquiry |
Ror1-01M | Active Recombinant Mouse Ror1 Protein (Gln30-Glu403), C-mFc-tagged | +Inquiry |
Ror1-430M | Recombinant Full Length Mouse Ror1 Protein, His-tagged | +Inquiry |
ROR1-595H | Recombinant Human ROR1 Protein (Met1-Glu403), Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ROR1-001HCL | Recombinant Human ROR1 cell lysate | +Inquiry |
ROR1-002HCL | Recombinant Human ROR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROR1 Products
Required fields are marked with *
My Review for All ROR1 Products
Required fields are marked with *