Recombinant Human ROR1 protein, His-tagged
| Cat.No. : | ROR1-3437H |
| Product Overview : | Recombinant Human ROR1 protein(Q01973)(30-391aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 30-391aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.6 kDa |
| AA Sequence : | QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ] |
| Official Symbol | ROR1 |
| Synonyms | ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1; neurotrophic tyrosine kinase receptor-related 1; neurotrophic tyrosine kinase, receptor-related 1; dJ537F10.1; MGC99659; |
| Gene ID | 4919 |
| mRNA Refseq | NM_001083592 |
| Protein Refseq | NP_001077061 |
| MIM | 602336 |
| UniProt ID | Q01973 |
| ◆ Recombinant Proteins | ||
| ROR1-1936H | Active Recombinant Human ROR1 protein, Fc-tagged, FITC-Labeled | +Inquiry |
| ROR1-183H | Recombinant Human/Cynomolgus/Rhesus macaque ROR1 protein, hFc-tagged | +Inquiry |
| ROR1-0659M | Recombinant Mouse ROR1 protein, Fc-tagged | +Inquiry |
| ROR1-1814H | Recombinant Human ROR1 protein, His-tagged | +Inquiry |
| Ror1-430M | Recombinant Full Length Mouse Ror1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ROR1-002HCL | Recombinant Human ROR1 cell lysate | +Inquiry |
| ROR1-001HCL | Recombinant Human ROR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROR1 Products
Required fields are marked with *
My Review for All ROR1 Products
Required fields are marked with *
