Recombinant Human ROR1 protein, T7/His-tagged

Cat.No. : ROR1-88H
Product Overview : Recombinant human ROR1 extracellular domain cDNA (30-406 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 30-406 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGEFQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAE LHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFG PPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPS LCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGI PMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFT LDENFKSDLCDIPACDSKDSKEKNKMEILY
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro ROR1 mediated T cell and neuronal cell differentiation regulation study with this protein either as soluble factor or as coating matrix protein.2. May be used for protein-protein interaction assay.3. Potential biomarker protein for cancer therapy applications.4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ]
Official Symbol ROR1
Synonyms ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1; neurotrophic tyrosine kinase receptor-related 1; neurotrophic tyrosine kinase, receptor-related 1; dJ537F10.1; MGC99659;
Gene ID 4919
mRNA Refseq NM_001083592
Protein Refseq NP_001077061
MIM 602336
UniProt ID Q01973
Chromosome Location 1p32-p31
Pathway Nuclear Receptors, organism-specific biosystem;
Function ATP binding; Wnt-protein binding; kinase activity; nucleotide binding; receptor activity; transmembrane receptor protein tyrosine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ROR1 Products

Required fields are marked with *

My Review for All ROR1 Products

Required fields are marked with *

0
cart-icon