Recombinant Human ROR1 protein, T7/His-tagged
| Cat.No. : | ROR1-88H |
| Product Overview : | Recombinant human ROR1 extracellular domain cDNA (30-406 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 30-406 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGEFQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAE LHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFG PPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPS LCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGI PMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFT LDENFKSDLCDIPACDSKDSKEKNKMEILY |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro ROR1 mediated T cell and neuronal cell differentiation regulation study with this protein either as soluble factor or as coating matrix protein.2. May be used for protein-protein interaction assay.3. Potential biomarker protein for cancer therapy applications.4. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ] |
| Official Symbol | ROR1 |
| Synonyms | ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1; neurotrophic tyrosine kinase receptor-related 1; neurotrophic tyrosine kinase, receptor-related 1; dJ537F10.1; MGC99659; |
| Gene ID | 4919 |
| mRNA Refseq | NM_001083592 |
| Protein Refseq | NP_001077061 |
| MIM | 602336 |
| UniProt ID | Q01973 |
| Chromosome Location | 1p32-p31 |
| Pathway | Nuclear Receptors, organism-specific biosystem; |
| Function | ATP binding; Wnt-protein binding; kinase activity; nucleotide binding; receptor activity; transmembrane receptor protein tyrosine kinase activity; |
| ◆ Recombinant Proteins | ||
| ROR1-198HF | Recombinant Human ROR1 Protein, His-tagged, FITC conjugated | +Inquiry |
| ROR1-14377M | Recombinant Mouse ROR1 Protein | +Inquiry |
| Ror1-192MAF488 | Recombinant Mouse Ror1 Protein, hFc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ROR1-140HFL | Active Recombinant Full Length Human ROR1 Protein, C-Flag-tagged | +Inquiry |
| ROR1-198H | Active Recombinant Human ROR1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ROR1-002HCL | Recombinant Human ROR1 cell lysate | +Inquiry |
| ROR1-001HCL | Recombinant Human ROR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROR1 Products
Required fields are marked with *
My Review for All ROR1 Products
Required fields are marked with *
