Recombinant Human RORC protein, His-tagged

Cat.No. : RORC-5893H
Product Overview : Recombinant Human RORC protein (165-518 aa) is produced by E. coli-derived, PET28a expression system. This protein is fused with a His tag.
Availability July 26, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 165-518 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.0). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Molecular Mass : 44 kDa
AA Sequence : DLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Purity : > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Storage : Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name RORC RAR-related orphan receptor C [ Homo sapiens ]
Official Symbol RORC
Synonyms RORC; NR1F3; RORG; RZRG; TOR; RZR-GAMMA; MGC129539;
Gene ID 6097
mRNA Refseq NM_001001523
Protein Refseq NP_001001523
MIM 602943
UniProt ID P51449

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RORC Products

Required fields are marked with *

My Review for All RORC Products

Required fields are marked with *

0
cart-icon