Recombinant Human RORC protein, His-tagged
Cat.No. : | RORC-5893H |
Product Overview : | Recombinant Human RORC protein (165-518 aa) is produced by E. coli-derived, PET28a expression system. This protein is fused with a His tag. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 165-518 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.0). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Molecular Mass : | 44 kDa |
AA Sequence : | DLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK |
Purity : | > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | RORC RAR-related orphan receptor C [ Homo sapiens ] |
Official Symbol | RORC |
Synonyms | RORC; NR1F3; RORG; RZRG; TOR; RZR-GAMMA; MGC129539; |
Gene ID | 6097 |
mRNA Refseq | NM_001001523 |
Protein Refseq | NP_001001523 |
MIM | 602943 |
UniProt ID | P51449 |
◆ Recombinant Proteins | ||
RORC-4796HFL | Recombinant Full Length Human RORC protein, Flag-tagged | +Inquiry |
RORC-18H | Recombinant Human RORC protein, GST-tagged | +Inquiry |
RORC-2011M | Recombinant Mouse RORC Protein (1-516 aa), His-tagged | +Inquiry |
Rorc-2027M | Recombinant Mouse Rorc Protein, His-tagged | +Inquiry |
RORC-062H | Recombinant Human RAR-related orphan receptor C Protein, His&Flag&StrepII tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RORC-2245HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
RORC-2244HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RORC Products
Required fields are marked with *
My Review for All RORC Products
Required fields are marked with *