Recombinant Human RPAIN protein, GST-tagged
| Cat.No. : | RPAIN-5633H |
| Product Overview : | Recombinant Human RPAIN protein(1-145 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-145 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVCTNLLS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RPAIN RPA interacting protein [ Homo sapiens ] |
| Official Symbol | RPAIN |
| Synonyms | RPAIN; RPA interacting protein; RPA-interacting protein; hRIP; MGC4189; RIP; nuclear transporter; RAP interaction protein; HRIP; FLJ25625; FLJ30490; FLJ42429; |
| Gene ID | 84268 |
| mRNA Refseq | NM_001033002 |
| Protein Refseq | NP_001028174 |
| UniProt ID | Q86UA6 |
| ◆ Recombinant Proteins | ||
| RPAIN-4759R | Recombinant Rat RPAIN Protein, His (Fc)-Avi-tagged | +Inquiry |
| RPAIN-5100R | Recombinant Rat RPAIN Protein | +Inquiry |
| RPAIN-15919H | Recombinant Human RPAIN, His-tagged | +Inquiry |
| RPAIN-5633H | Recombinant Human RPAIN protein, GST-tagged | +Inquiry |
| RPAIN-4357Z | Recombinant Zebrafish RPAIN | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPAIN-2239HCL | Recombinant Human RPAIN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPAIN Products
Required fields are marked with *
My Review for All RPAIN Products
Required fields are marked with *
