Recombinant Human RPE Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RPE-5843H |
Product Overview : | RPE MS Standard C13 and N15-labeled recombinant protein (NP_954699) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RPE (Ribulose-5-Phosphate-3-Epimerase) is a Protein Coding gene. Diseases associated with RPE include Cardiomyopathy, Familial Restrictive, 2. Among its related pathways are Pentose phosphate pathway and Metabolism. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and racemase and epimerase activity, acting on carbohydrates and derivatives. An important paralog of this gene is RPEL1. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RPE ribulose-5-phosphate-3-epimerase [ Homo sapiens (human) ] |
Official Symbol | RPE |
Synonyms | RPE; ribulose-5-phosphate-3-epimerase; ribulose-phosphate 3-epimerase; RPE2-1; MGC2636; |
Gene ID | 6120 |
mRNA Refseq | NM_199229 |
Protein Refseq | NP_954699 |
MIM | 180480 |
UniProt ID | Q96AT9 |
◆ Recombinant Proteins | ||
RPE-3781R | Recombinant Rhesus Macaque RPE Protein, His (Fc)-Avi-tagged | +Inquiry |
RPE-8053Z | Recombinant Zebrafish RPE | +Inquiry |
RPE-1867B | Recombinant Bacillus subtilis RPE protein, His-tagged | +Inquiry |
RPE-6196H | Recombinant Human RPE Protein (Met1-Arg228), C-His tagged | +Inquiry |
Rpe-7409M | Recombinant Full Length Mouse Rpe protein(Met1-Arg228), His-tagged | +Inquiry |
◆ Native Proteins | ||
RPE-426 | Native RPE | +Inquiry |
RPE-425 | Native Red algae RPE | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPE-1419MCL | Recombinant Mouse RPE cell lysate | +Inquiry |
RPE-2233HCL | Recombinant Human RPE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPE Products
Required fields are marked with *
My Review for All RPE Products
Required fields are marked with *