Recombinant Human RPGRIP1 protein, GST-tagged
Cat.No. : | RPGRIP1-301283H |
Product Overview : | Recombinant Human RPGRIP1 (157-220 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Thr157-Ile220 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | TTLELEKTRDMLILQRKINVCYQEELEAMMTKADNDNRDHKEKLERLTRLLDLKNNRIKQLEGI |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RPGRIP1 RPGR interacting protein 1 [ Homo sapiens (human) ] |
Official Symbol | RPGRIP1 |
Synonyms | LCA6; RGI1; RGRIP; CORD13; RPGRIP; RPGRIP1d |
Gene ID | 57096 |
mRNA Refseq | NM_001377523 |
Protein Refseq | NP_001364452 |
MIM | 605446 |
◆ Recombinant Proteins | ||
RPGRIP1-4004H | Recombinant Human RPGRIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rpgrip1-2032M | Recombinant Mouse Rpgrip1 Protein, His-tagged | +Inquiry |
RPGRIP1-2660H | Recombinant Human RPGRIP1 Protein, His-tagged | +Inquiry |
RPGRIP1-755H | Recombinant Human RPGRIP1 | +Inquiry |
RPGRIP1-2372H | Recombinant Human RPGRIP1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPGRIP1-2233HCL | Recombinant Human RPGRIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPGRIP1 Products
Required fields are marked with *
My Review for All RPGRIP1 Products
Required fields are marked with *
0
Inquiry Basket