Recombinant Human RPIA protein, GST-tagged
Cat.No. : | RPIA-6744H |
Product Overview : | Recombinant Human RPIA protein(1-311 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-311 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTSTSCGDSNSICPAPSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQDGSVNMREKPFC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | RPIA ribose 5-phosphate isomerase A [ Homo sapiens ] |
Official Symbol | RPIA |
Synonyms | RPIA; ribose 5-phosphate isomerase A; ribose-5-phosphate isomerase; ribose 5 phosphate epimerase; phosphoriboisomerase; ribose 5-phosphate epimerase; RPI; |
Gene ID | 22934 |
mRNA Refseq | NM_144563 |
Protein Refseq | NP_653164 |
MIM | 180430 |
UniProt ID | P49247 |
◆ Recombinant Proteins | ||
RPIA-3785R | Recombinant Rhesus Macaque RPIA Protein, His (Fc)-Avi-tagged | +Inquiry |
RPIA-14402M | Recombinant Mouse RPIA Protein | +Inquiry |
RPIA-2838C | Recombinant Chicken RPIA | +Inquiry |
RPIA-31148TH | Recombinant Human RPIA, His-tagged | +Inquiry |
RPIA-3968R | Recombinant Rhesus monkey RPIA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPIA-2231HCL | Recombinant Human RPIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPIA Products
Required fields are marked with *
My Review for All RPIA Products
Required fields are marked with *