Recombinant Human RPL23AP82 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RPL23AP82-3489H
• Product Overview: MGC70863 MS Standard C13 and N15-labeled recombinant protein (NP_976047) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RPL23AP82 (Ribosomal Protein L23a Pseudogene 82) is a Pseudogene.
• Molecular Mass: 13.7 kDa
• AA Sequence: MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIEENNTLVFTVDVKANKHQIRQAVKKLYDSDVAKVTTLICPDKENKAYVRLAPDYDAFDVVTKLGSPKLSPAGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RPL23AP82 ribosomal protein L23a pseudogene 82 [ Homo sapiens (human) ]
• Official Symbol: RPL23AP82
• Synonyms: RPL23AP82; ribosomal protein L23a pseudogene 82; MGC70863
• Gene ID: 284942
• mRNA Refseq: NM_203302
• Protein Refseq: NP_976047