Recombinant Human RPL23AP82 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RPL23AP82-3489H
Product Overview : MGC70863 MS Standard C13 and N15-labeled recombinant protein (NP_976047) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RPL23AP82 (Ribosomal Protein L23a Pseudogene 82) is a Pseudogene.
Molecular Mass : 13.7 kDa
AA Sequence : MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIEENNTLVFTVDVKANKHQIRQAVKKLYDSDVAKVTTLICPDKENKAYVRLAPDYDAFDVVTKLGSPKLSPAGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RPL23AP82 ribosomal protein L23a pseudogene 82 [ Homo sapiens (human) ]
Official Symbol RPL23AP82
Synonyms RPL23AP82; ribosomal protein L23a pseudogene 82; MGC70863;
Gene ID 284942
mRNA Refseq NM_203302
Protein Refseq NP_976047

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPL23AP82 Products

Required fields are marked with *

My Review for All RPL23AP82 Products

Required fields are marked with *

0
cart-icon