Recombinant Human RPL24 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RPL24-2774H
Product Overview : RPL24 MS Standard C13 and N15-labeled recombinant protein (NP_000977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L24E family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as ribosomal protein L30 because the encoded protein shares amino acid identity with the L30 ribosomal proteins from S. cerevisiae; however, its official name is ribosomal protein L24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Mass : 17.8 kDa
AA Sequence : MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RPL24 ribosomal protein L24 [ Homo sapiens (human) ]
Official Symbol RPL24
Synonyms RPL24; ribosomal protein L24; L24; HEL-S-310; 60S ribosomal protein L24; 60S ribosomal protein L30; epididymis secretory protein Li 310; large ribosomal subunit protein eL24; ribosomal protein L30
Gene ID 6152
mRNA Refseq NM_000986
Protein Refseq NP_000977
MIM 604180
UniProt ID P83731

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPL24 Products

Required fields are marked with *

My Review for All RPL24 Products

Required fields are marked with *

0
cart-icon