Recombinant Human RPL26 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RPL26-2659H |
Product Overview : | RPL26 MS Standard C13 and N15-labeled recombinant protein (NP_000978) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L24P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Mutations in this gene result in Diamond-Blackfan anemia. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKMQETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RPL26 ribosomal protein L26 [ Homo sapiens (human) ] |
Official Symbol | RPL26 |
Synonyms | RPL26; ribosomal protein L26; 60S ribosomal protein L26; L26; |
Gene ID | 6154 |
mRNA Refseq | NM_000987 |
Protein Refseq | NP_000978 |
MIM | 603704 |
UniProt ID | P61254 |
◆ Recombinant Proteins | ||
RPL26-2386H | Recombinant Human RPL26, GST-tagged | +Inquiry |
RPL26-235H | Recombinant Human ribosomal protein L26, His-tagged | +Inquiry |
RPL26-7731M | Recombinant Mouse RPL26 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL26-12336Z | Recombinant Zebrafish RPL26 | +Inquiry |
RPL26-3797R | Recombinant Rhesus Macaque RPL26 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL26-2213HCL | Recombinant Human RPL26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPL26 Products
Required fields are marked with *
My Review for All RPL26 Products
Required fields are marked with *
0
Inquiry Basket