Recombinant Human RPL5, His-tagged

Cat.No. : RPL5-31335TH
Product Overview : Recombinant fragment, corresponding to amino acids 99-297 of Human RPL5 with an N terminal His tag. Predicted mwt: 24 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 99-297 a.a.
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18P family of ribosomal proteins. It is located in the cytoplasm. The protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The protein interacts specifically with the beta subunit of casein kinase II. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 46 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQ PGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHS TKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEE DEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYE KKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQE RAAES
Sequence Similarities : Belongs to the ribosomal protein L18P family.
Gene Name RPL5 ribosomal protein L5 [ Homo sapiens ]
Official Symbol RPL5
Synonyms RPL5; ribosomal protein L5; 60S ribosomal protein L5; L5;
Gene ID 6125
mRNA Refseq NM_000969
Protein Refseq NP_000960
MIM 603634
Uniprot ID P46777
Chromosome Location 1p22.1
Pathway Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Eukaryotic Translation Elongation, organism-specific biosystem;
Function 5S rRNA binding; RNA binding; protein binding; structural constituent of ribosome; structural constituent of ribosome;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPL5 Products

Required fields are marked with *

My Review for All RPL5 Products

Required fields are marked with *

0
cart-icon
0
compare icon