Recombinant Human RPLP0 protein(11-310 aa), C-His-tagged
Cat.No. : | RPLP0-2559H |
Product Overview : | Recombinant Human RPLP0 protein(P05388)(11-310 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-310 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 34.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEAKEESEESDED |
◆ Recombinant Proteins | ||
RPLP0-3997R | Recombinant Rhesus monkey RPLP0 Protein, His-tagged | +Inquiry |
RPLP0-0546H | Recombinant Human RPLP0 Protein (Met1-Asp317), C-His-tagged | +Inquiry |
RPLP0-666H | Recombinant Human RPLP0 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RPLP0-1911H | Recombinant Human RPLP0 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPLP0-14452M | Recombinant Mouse RPLP0 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPLP0-2184HCL | Recombinant Human RPLP0 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPLP0 Products
Required fields are marked with *
My Review for All RPLP0 Products
Required fields are marked with *
0
Inquiry Basket