Recombinant Human RPLP2 protein, His-tagged
Cat.No. : | RPLP2-3111H |
Product Overview : | Recombinant Human RPLP2 protein(45-110 aa), fused to His tag, was expressed in E. coli. |
Availability | August 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 45-110 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RPLP2 ribosomal protein, large, P2 [ Homo sapiens ] |
Official Symbol | RPLP2 |
Synonyms | RPLP2; ribosomal protein, large, P2; D11S2243E; 60S acidic ribosomal protein P2; acidic ribosomal phosphoprotein P2; LP2; MGC71408; P2; RPP2; renal carcinoma antigen NY-REN-44; |
Gene ID | 6181 |
mRNA Refseq | NM_001004 |
Protein Refseq | NP_000995 |
MIM | 180530 |
UniProt ID | P05387 |
◆ Recombinant Proteins | ||
RPLP2-2405H | Recombinant Human RPLP2, GST-tagged | +Inquiry |
RPLP2-4800R | Recombinant Rat RPLP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPLP2-3816R | Recombinant Rhesus Macaque RPLP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPLP2-5141R | Recombinant Rat RPLP2 Protein | +Inquiry |
RPLP2-7758M | Recombinant Mouse RPLP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPLP2-1541HCL | Recombinant Human RPLP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPLP2 Products
Required fields are marked with *
My Review for All RPLP2 Products
Required fields are marked with *