Recombinant Human RPP25L Protein, GST-tagged

Cat.No. : RPP25L-5220H
Product Overview : Human C9orf23 full-length ORF ( NP_680544.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Molecular Mass : 44 kDa
AA Sequence : MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RPP25L ribonuclease P/MRP subunit p25 like [ Homo sapiens (human) ]
Official Symbol RPP25L
Synonyms C9orf23; RPP25L; ribonuclease P/MRP subunit p25 like; bA296L22.5; ribonuclease P protein subunit p25-like protein; RNase P protein subunit-like p25; alba-like protein C9orf23; ribonuclease P/MRP 25kDa subunit-like; rpp25-like protein
Gene ID 138716
mRNA Refseq NM_148178
Protein Refseq NP_680544
UniProt ID Q8N5L8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPP25L Products

Required fields are marked with *

My Review for All RPP25L Products

Required fields are marked with *

0
cart-icon