Recombinant Human RPP25L Protein, GST-tagged
Cat.No. : | RPP25L-5220H |
Product Overview : | Human C9orf23 full-length ORF ( NP_680544.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 44 kDa |
AA Sequence : | MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RPP25L ribonuclease P/MRP subunit p25 like [ Homo sapiens (human) ] |
Official Symbol | RPP25L |
Synonyms | C9orf23; RPP25L; ribonuclease P/MRP subunit p25 like; bA296L22.5; ribonuclease P protein subunit p25-like protein; RNase P protein subunit-like p25; alba-like protein C9orf23; ribonuclease P/MRP 25kDa subunit-like; rpp25-like protein |
Gene ID | 138716 |
mRNA Refseq | NM_148178 |
Protein Refseq | NP_680544 |
UniProt ID | Q8N5L8 |
◆ Recombinant Proteins | ||
RPP25L-663Z | Recombinant Zebrafish RPP25L | +Inquiry |
RPP25L-5220H | Recombinant Human RPP25L Protein, GST-tagged | +Inquiry |
RPP25L-3821R | Recombinant Rhesus Macaque RPP25L Protein, His (Fc)-Avi-tagged | +Inquiry |
RPP25L-3850HF | Recombinant Full Length Human RPP25L Protein, GST-tagged | +Inquiry |
RPP25L-4004R | Recombinant Rhesus monkey RPP25L Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPP25L-7936HCL | Recombinant Human C9orf23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPP25L Products
Required fields are marked with *
My Review for All RPP25L Products
Required fields are marked with *