Recombinant Human RPS10P5 Protein, His-SUMO-tagged
Cat.No. : | RPS10P5-1359H |
Product Overview : | Recombinant Human RPS10P5 Protein (1-176aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-176 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 36.1 kDa |
AA Sequence : | MLMPKKNRIAIHELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGCVKEQFAWRHFYWY LTNEGSQYLRDYLHLPPEIVPATLHLPPEIVPATLHRSRPETGRPRPKGLEGKRPARLTRREADRDTYRR CSVPPGADKKAEAGAGSATEFQFRGRCGRGRGQPPQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | RPS10P5 ribosomal protein S10 pseudogene 5 [ Homo sapiens (human) ] |
Official Symbol | RPS10P5 |
Synonyms | RPS10L; bA371L19.2; RPS10_13_1677 |
Gene ID | 93144 |
UniProt ID | Q9NQ39 |
◆ Recombinant Proteins | ||
RPS10P5-1359H | Recombinant Human RPS10P5 Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS10P5 Products
Required fields are marked with *
My Review for All RPS10P5 Products
Required fields are marked with *