Recombinant Human RPS13 protein(61-140 aa), C-His-tagged

• Cat.No.: RPS13-2802H
• Product Overview: Recombinant Human RPS13 protein(P62277)(61-140 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 61-140 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWK

Gene Information

• Gene Name: RPS13 ribosomal protein S13 [ Homo sapiens ]
• Official Symbol: RPS13
• Synonyms: RPS13; ribosomal protein S13; 40S ribosomal protein S13; S13
• Gene ID: 6207
• mRNA Refseq: NM_001017
• Protein Refseq: NP_001008
• MIM: 180476
• UniProt ID: P62277