Recombinant Human RPS13 protein, His-tagged
Cat.No. : | RPS13-3261H |
Product Overview : | Recombinant Human RPS13 protein(27-113 aa), fused to His tag, was expressed in E. coli. |
Availability | August 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-113 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RPS13 ribosomal protein S13 [ Homo sapiens ] |
Official Symbol | RPS13 |
Synonyms | RPS13; ribosomal protein S13; 40S ribosomal protein S13; S13; |
Gene ID | 6207 |
mRNA Refseq | NM_001017 |
Protein Refseq | NP_001008 |
MIM | 180476 |
UniProt ID | P62277 |
◆ Recombinant Proteins | ||
RPS13-3829R | Recombinant Rhesus Macaque RPS13 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS13-2802H | Recombinant Human RPS13 protein(61-140 aa), C-His-tagged | +Inquiry |
RPS13-4012R | Recombinant Rhesus monkey RPS13 Protein, His-tagged | +Inquiry |
RPS13-14468M | Recombinant Mouse RPS13 Protein | +Inquiry |
RPS13-2415H | Recombinant Human RPS13, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS13-558HCL | Recombinant Human RPS13 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS13 Products
Required fields are marked with *
My Review for All RPS13 Products
Required fields are marked with *