Recombinant Human RPS13 protein, His-tagged
| Cat.No. : | RPS13-3261H |
| Product Overview : | Recombinant Human RPS13 protein(27-113 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 05, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 27-113 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | KLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKF |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RPS13 ribosomal protein S13 [ Homo sapiens ] |
| Official Symbol | RPS13 |
| Synonyms | RPS13; ribosomal protein S13; 40S ribosomal protein S13; S13; |
| Gene ID | 6207 |
| mRNA Refseq | NM_001017 |
| Protein Refseq | NP_001008 |
| MIM | 180476 |
| UniProt ID | P62277 |
| ◆ Recombinant Proteins | ||
| RPS13-5182H | Recombinant Human RPS13 protein, GST-tagged | +Inquiry |
| RPS13-311Z | Recombinant Zebrafish RPS13 | +Inquiry |
| RPS13-7769M | Recombinant Mouse RPS13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RPS13-4012R | Recombinant Rhesus monkey RPS13 Protein, His-tagged | +Inquiry |
| RPS13-2577C | Recombinant Ciona Intestinalis RPS13 Protein (2-151 aa), His-Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPS13-558HCL | Recombinant Human RPS13 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS13 Products
Required fields are marked with *
My Review for All RPS13 Products
Required fields are marked with *
