Recombinant Human RPS19
Cat.No. : | RPS19-29469TH |
Product Overview : | Recombinant fragment of Human RPS19 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19E family of ribosomal proteins. It is located in the cytoplasm. Mutations in this gene cause Diamond-Blackfan anemia (DBA), a constitutional erythroblastopenia characterized by absent or decreased erythroid precursors, in a subset of patients. This suggests a possible extra-ribosomal function for this gene in erythropoietic differentiation and proliferation, in addition to its ribosomal function. Higher expression levels of this gene in some primary colon carcinomas compared to matched normal colon tissues has been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Higher level expression is seen in the colon carcinoma tissue than normal colon tissue. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | APYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH |
Sequence Similarities : | Belongs to the ribosomal protein S19e family. |
Gene Name | RPS19 ribosomal protein S19 [ Homo sapiens ] |
Official Symbol | RPS19 |
Synonyms | RPS19; ribosomal protein S19; 40S ribosomal protein S19; DBA; Diamond Blackfan anemia; S19; |
Gene ID | 6223 |
mRNA Refseq | NM_001022 |
Protein Refseq | NP_001013 |
MIM | 603474 |
Uniprot ID | P39019 |
Chromosome Location | 19q13.2 |
Pathway | Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; |
Function | RNA binding; protein binding; structural constituent of ribosome; |
◆ Recombinant Proteins | ||
RPS19-5156R | Recombinant Rat RPS19 Protein | +Inquiry |
RPS19-2258H | Recombinant Human RPS19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RPS19-693H | Recombinant Human RPS19 Protein, His-tagged | +Inquiry |
RPS19-2420H | Recombinant Human RPS19 protein, GST-tagged | +Inquiry |
RPS19-6204H | Recombinant Human RPS19 Protein (Pro2-His145) | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS19-2169HCL | Recombinant Human RPS19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS19 Products
Required fields are marked with *
My Review for All RPS19 Products
Required fields are marked with *