Recombinant Human RPS27 protein, GST-tagged
Cat.No. : | RPS27-3449H |
Product Overview : | Recombinant Human RPS27 protein(P42677)(1-84aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-84aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RPS27 ribosomal protein S27 [ Homo sapiens ] |
Official Symbol | RPS27 |
Synonyms | RPS27; ribosomal protein S27; ribosomal protein S27 (metallopanstimulin 1); 40S ribosomal protein S27; metallopanstimulin 1; MPS 1; MPS1; S27; metallopan-stimulin 1; MPS-1; |
Gene ID | 6232 |
mRNA Refseq | NM_001030 |
Protein Refseq | NP_001021 |
MIM | 603702 |
UniProt ID | P42677 |
◆ Recombinant Proteins | ||
RPS27-7783M | Recombinant Mouse RPS27 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS27-14484M | Recombinant Mouse RPS27 Protein | +Inquiry |
RPS27-4823R | Recombinant Rat RPS27 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS27-5164R | Recombinant Rat RPS27 Protein | +Inquiry |
RPS27-3449H | Recombinant Human RPS27 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS27 Products
Required fields are marked with *
My Review for All RPS27 Products
Required fields are marked with *