Recombinant Human RPS4Y1 protein(1-263aa), His&Myc-tagged

Cat.No. : RPS4Y1-8630H
Product Overview : Recombinant Human RPS4Y1 protein(P22090)(1-263aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 1-263aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.9 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG
Gene Name RPS4Y1 ribosomal protein S4, Y-linked 1 [ Homo sapiens ]
Official Symbol RPS4Y1
Synonyms RPS4Y1; ribosomal protein S4, Y-linked 1; ribosomal protein S4, Y linked , RPS4Y; 40S ribosomal protein S4, Y isoform 1; 40S ribosomal protein S4; Y; MGC5070; MGC119100; ribosomal protein S4Y; S4; 40S ribosomal protein S4, Y; RPS4Y;
Gene ID 6192
mRNA Refseq NM_001008
Protein Refseq NP_000999
MIM 470000
UniProt ID P22090

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPS4Y1 Products

Required fields are marked with *

My Review for All RPS4Y1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon