Recombinant Human RPS4Y1 protein(1-263aa), His&Myc-tagged
| Cat.No. : | RPS4Y1-8630H | 
| Product Overview : | Recombinant Human RPS4Y1 protein(P22090)(1-263aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&Myc | 
| Protein Length : | 1-263aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 36.9 kDa | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG | 
| Gene Name | RPS4Y1 ribosomal protein S4, Y-linked 1 [ Homo sapiens ] | 
| Official Symbol | RPS4Y1 | 
| Synonyms | RPS4Y1; ribosomal protein S4, Y-linked 1; ribosomal protein S4, Y linked , RPS4Y; 40S ribosomal protein S4, Y isoform 1; 40S ribosomal protein S4; Y; MGC5070; MGC119100; ribosomal protein S4Y; S4; 40S ribosomal protein S4, Y; RPS4Y; | 
| Gene ID | 6192 | 
| mRNA Refseq | NM_001008 | 
| Protein Refseq | NP_000999 | 
| MIM | 470000 | 
| UniProt ID | P22090 | 
| ◆ Recombinant Proteins | ||
| RPS4Y1-451H | Recombinant Human RPS4Y1 Protein, His-tagged | +Inquiry | 
| RPS4Y1-3843R | Recombinant Rhesus Macaque RPS4Y1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| RPS4Y1-4026R | Recombinant Rhesus monkey RPS4Y1 Protein, His-tagged | +Inquiry | 
| RPS4Y1-8630H | Recombinant Human RPS4Y1 protein(1-263aa), His&Myc-tagged | +Inquiry | 
| RPS4Y1-2430H | Recombinant Human RPS4Y1, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| RPS4Y1-565HCL | Recombinant Human RPS4Y1 lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS4Y1 Products
Required fields are marked with *
My Review for All RPS4Y1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            