Recombinant Human RPS4Y1 Protein, His-tagged
Cat.No. : | RPS4Y1-451H |
Product Overview : | Recombinant Human RPS4Y1 Protien(NP_000999)(6-263 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 6-263 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | KKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | RPS4Y1 ribosomal protein S4, Y-linked 1 [ Homo sapiens ] |
Official Symbol | RPS4Y1 |
Synonyms | RPS4Y1; ribosomal protein S4, Y-linked 1; ribosomal protein S4, Y linked , RPS4Y; 40S ribosomal protein S4, Y isoform 1; 40S ribosomal protein S4; Y; MGC5070; MGC119100; ribosomal protein S4Y; S4; 40S ribosomal protein S4, Y; RPS4Y; |
Gene ID | 6192 |
mRNA Refseq | NM_001008 |
Protein Refseq | NP_000999 |
MIM | 470000 |
UniProt ID | P22090 |
◆ Recombinant Proteins | ||
RPS4Y1-8630H | Recombinant Human RPS4Y1 protein(1-263aa), His&Myc-tagged | +Inquiry |
RPS4Y1-3843R | Recombinant Rhesus Macaque RPS4Y1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS4Y1-2430H | Recombinant Human RPS4Y1, GST-tagged | +Inquiry |
RPS4Y1-4026R | Recombinant Rhesus monkey RPS4Y1 Protein, His-tagged | +Inquiry |
RPS4Y1-451H | Recombinant Human RPS4Y1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS4Y1-565HCL | Recombinant Human RPS4Y1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS4Y1 Products
Required fields are marked with *
My Review for All RPS4Y1 Products
Required fields are marked with *
0
Inquiry Basket