Recombinant Human RPS6KA3 protein, His-tagged

• Cat.No.: RPS6KA3-0425H
• Product Overview: Recombinant Human RPS6KA3 protein(666-740 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 666-740 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: QRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RPS6KA3 ribosomal protein S6 kinase, 90kDa, polypeptide 3 [ Homo sapiens ]
• Official Symbol: RPS6KA3
• Synonyms: RPS6KA3; ribosomal protein S6 kinase, 90kDa, polypeptide 3; CLS, Coffin Lowry syndrome , mental retardation, X linked 19 , MRX19, ribosomal protein S6 kinase, 90kD, polypeptide 3; ribosomal protein S6 kinase alpha-3; HU 3; RSK; RSK2; RSK-2; p90-RSK 3; MAPKAPK-1b; S6K-alpha-3; MAPKAP kinase 1b; ribosomal S6 kinase 2; MAPK-activated protein kinase 1b; insulin-stimulated protein kinase 1; MAP kinase-activated protein kinase 1b; CLS; HU-3; MRX19; ISPK-1; p90-RSK2; pp90RSK2; MAPKAPK1B; S6K-alpha3
• Gene ID: 6197
• mRNA Refseq: NM_004586
• Protein Refseq: NP_004577
• MIM: 300075
• UniProt ID: P51812