Recombinant Human RPS6KA3 protein, His-tagged

Cat.No. : RPS6KA3-0425H
Product Overview : Recombinant Human RPS6KA3 protein(666-740 aa), fused to His tag, was expressed in E. coli.
Availability August 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 666-740 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : QRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name RPS6KA3 ribosomal protein S6 kinase, 90kDa, polypeptide 3 [ Homo sapiens ]
Official Symbol RPS6KA3
Synonyms RPS6KA3; ribosomal protein S6 kinase, 90kDa, polypeptide 3; CLS, Coffin Lowry syndrome , mental retardation, X linked 19 , MRX19, ribosomal protein S6 kinase, 90kD, polypeptide 3; ribosomal protein S6 kinase alpha-3; HU 3; RSK; RSK2; RSK-2; p90-RSK 3; MAPKAPK-1b; S6K-alpha-3; MAPKAP kinase 1b; ribosomal S6 kinase 2; MAPK-activated protein kinase 1b; insulin-stimulated protein kinase 1; MAP kinase-activated protein kinase 1b; CLS; HU-3; MRX19; ISPK-1; p90-RSK2; pp90RSK2; MAPKAPK1B; S6K-alpha3;
Gene ID 6197
mRNA Refseq NM_004586
Protein Refseq NP_004577
MIM 300075
UniProt ID P51812

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPS6KA3 Products

Required fields are marked with *

My Review for All RPS6KA3 Products

Required fields are marked with *

0
cart-icon