Recombinant Human RPS6KB1, His-tagged
Cat.No. : | RPS6KB1-29261TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 14-525 of Human S6K with N terminal His tag; Predicted MWt 59 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 14-525 a.a. |
Description : | This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 88 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNES MDHGGVGPYELGMEHCEKFEISETSVNRGPEKIRPECF ELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAM IVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGK LYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALG HLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIH DGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALM YDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEAR DLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELL ARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDST LSESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRR FIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYP METSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL |
Sequence Similarities : | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.Contains 1 AGC-kinase C-terminal domain.Contains 1 protein kinase domain. |
Gene Name | RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 [ Homo sapiens ] |
Official Symbol | RPS6KB1 |
Synonyms | RPS6KB1; ribosomal protein S6 kinase, 70kDa, polypeptide 1; ribosomal protein S6 kinase, 70kD, polypeptide 1 , STK14A; ribosomal protein S6 kinase beta-1; p70(S6K) alpha; PS6K; S6K1; |
Gene ID | 6198 |
mRNA Refseq | NM_003161 |
Protein Refseq | NP_003152 |
MIM | 608938 |
Uniprot ID | P23443 |
Chromosome Location | 17q23.1 |
Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; peptide binding; protein binding; protein kinase activity; |
◆ Recombinant Proteins | ||
RPS6KB1-1153H | Recombinant Human RPS6KB1 Protein (R2-L525), GST tagged | +Inquiry |
RPS6KB1-3720H | Recombinant Human RPS6KB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Rps6kb1-5613M | Recombinant Mouse Rps6kb1 Protein, Myc/DDK-tagged | +Inquiry |
RPS6KB1-376H | Recombinant Full Length Human RPS6KB1, His-tagged, Active | +Inquiry |
RPS6KB1-5478H | Recombinant Human Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS6KB1-001HCL | Recombinant Human RPS6KB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS6KB1 Products
Required fields are marked with *
My Review for All RPS6KB1 Products
Required fields are marked with *
0
Inquiry Basket