Recombinant Human RPUSD2 protein, His-tagged
Cat.No. : | RPUSD2-2610H |
Product Overview : | Recombinant Human RPUSD2 protein(1-350 aa), fused to His tag, was expressed in E. coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MWLDRRGWLRVLGHWRYDLRRPSFTRTWSGDKGPMAETVSTQVGTEGGLRASHQQNGDAGGDAKVELSPGPPKPAGREVEPAPVGGEHPSAAAPGPGKHKKRRGATRERVVPPPKKRRTGVSFGDEHFAETSYYFEGGLRKVRPYYFDFRTYCKGRWVGHSLLHVFSTEFRAQPLAYYEAAVRAGRLQLNEKPVQDLNIVLKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFRHNTVIFILGKEHQLKELHPLHRLDRLTSGVLMFAKTAAVSERIHEQVRDRQLEKEYVCRVEGEFPTEEVTCKEPILVVSYKVGVCRVDPRGKPCETVFQR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RPUSD2 RNA pseudouridylate synthase domain containing 2 [ Homo sapiens ] |
Official Symbol | RPUSD2 |
Synonyms | RPUSD2; RNA pseudouridylate synthase domain containing 2; C15orf19, chromosome 15 open reading frame 19; RNA pseudouridylate synthase domain-containing protein 2; C18B11; FLJ31409; C18B11 homolog (44.9kD); C15orf19; |
Gene ID | 27079 |
mRNA Refseq | NM_152260 |
Protein Refseq | NP_689473 |
UniProt ID | Q8IZ73 |
◆ Recombinant Proteins | ||
Rpusd2-5617M | Recombinant Mouse Rpusd2 Protein, Myc/DDK-tagged | +Inquiry |
RPUSD2-14510M | Recombinant Mouse RPUSD2 Protein | +Inquiry |
RPUSD2-2610H | Recombinant Human RPUSD2 protein, His-tagged | +Inquiry |
RPUSD2-7802M | Recombinant Mouse RPUSD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPUSD2-2152HCL | Recombinant Human RPUSD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPUSD2 Products
Required fields are marked with *
My Review for All RPUSD2 Products
Required fields are marked with *