Recombinant Human RRAD
Cat.No. : | RRAD-30772TH |
Product Overview : | Recombinant fragment of Human RRAD with an N terminal proprietary tag; Predicted MW 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRS IVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYS VTDKGSFEKASELRVQLRRARQTDDVPIIL |
Sequence Similarities : | Belongs to the small GTPase superfamily. RGK family. |
Gene Name | RRAD Ras-related associated with diabetes [ Homo sapiens ] |
Official Symbol | RRAD |
Synonyms | RRAD; Ras-related associated with diabetes; GTP-binding protein RAD; RAD; REM3; |
Gene ID | 6236 |
mRNA Refseq | NM_001128850 |
Protein Refseq | NP_001122322 |
MIM | 179503 |
Uniprot ID | P55042 |
Chromosome Location | 16q22 |
Pathway | Insulin Signaling, organism-specific biosystem; |
Function | GTP binding; GTPase activity; calmodulin binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RRAD-10186Z | Recombinant Zebrafish RRAD | +Inquiry |
RRAD-1676HFL | Recombinant Full Length Human RRAD Protein, C-Flag-tagged | +Inquiry |
RRAD-1918H | Recombinant Human RRAD Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAD-30772TH | Recombinant Human RRAD | +Inquiry |
RRAD-2818H | Recombinant Human RRAD protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RRAD Products
Required fields are marked with *
My Review for All RRAD Products
Required fields are marked with *
0
Inquiry Basket