Recombinant Human RRP36 Protein, GST-Tagged
| Cat.No. : | RRP36-0109H |
| Product Overview : | Human C6orf153 full-length ORF (NP_149103.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | RRP36 functions at an early stage in the processing of 35S preribosomal RNA into the mature 18S species (Gerus et al., 2010 [PubMed 20038530]).[supplied by OMIM, Jul 2010] |
| Molecular Mass : | 56.2 kDa |
| AA Sequence : | MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RRP36 ribosomal RNA processing 36 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | RRP36 |
| Synonyms | C6orf153; dJ20C7.4 |
| Gene ID | 88745 |
| mRNA Refseq | NM_033112 |
| Protein Refseq | NP_149103 |
| MIM | 613475 |
| UniProt ID | Q96EU6 |
| ◆ Recombinant Proteins | ||
| RRP36-0109H | Recombinant Human RRP36 Protein, GST-Tagged | +Inquiry |
| RRP36-7819M | Recombinant Mouse RRP36 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RRP36-4907Z | Recombinant Zebrafish RRP36 | +Inquiry |
| RRP36-14532M | Recombinant Mouse RRP36 Protein | +Inquiry |
| RRP36-3479HF | Recombinant Full Length Human RRP36 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RRP36-7993HCL | Recombinant Human C6orf153 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RRP36 Products
Required fields are marked with *
My Review for All RRP36 Products
Required fields are marked with *




