Recombinant Full Length Human RRP36 Protein, GST-tagged
Cat.No. : | RRP36-3479HF |
Product Overview : | Human C6orf153 full-length ORF (NP_149103.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 259 amino acids |
Description : | RRP36 functions at an early stage in the processing of 35S preribosomal RNA into the mature 18S species (Gerus et al., 2010 [PubMed 20038530]).[supplied by OMIM, Jul 2010] |
Molecular Mass : | 56.2 kDa |
AA Sequence : | MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RRP36 ribosomal RNA processing 36 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RRP36 |
Synonyms | C6orf153; dJ20C7.4 |
Gene ID | 88745 |
mRNA Refseq | NM_033112 |
Protein Refseq | NP_149103 |
MIM | 613475 |
UniProt ID | Q96EU6 |
◆ Recombinant Proteins | ||
RRP36-3479HF | Recombinant Full Length Human RRP36 Protein, GST-tagged | +Inquiry |
RRP36-4907Z | Recombinant Zebrafish RRP36 | +Inquiry |
RRP36-7819M | Recombinant Mouse RRP36 Protein, His (Fc)-Avi-tagged | +Inquiry |
RRP36-0109H | Recombinant Human RRP36 Protein, GST-Tagged | +Inquiry |
RRP36-14532M | Recombinant Mouse RRP36 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRP36-7993HCL | Recombinant Human C6orf153 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RRP36 Products
Required fields are marked with *
My Review for All RRP36 Products
Required fields are marked with *
0
Inquiry Basket