Recombinant Full Length Human RRP36 Protein, GST-tagged

Cat.No. : RRP36-3479HF
Product Overview : Human C6orf153 full-length ORF (NP_149103.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 259 amino acids
Description : RRP36 functions at an early stage in the processing of 35S preribosomal RNA into the mature 18S species (Gerus et al., 2010 [PubMed 20038530]).[supplied by OMIM, Jul 2010]
Molecular Mass : 56.2 kDa
AA Sequence : MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RRP36 ribosomal RNA processing 36 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol RRP36
Synonyms C6orf153; dJ20C7.4
Gene ID 88745
mRNA Refseq NM_033112
Protein Refseq NP_149103
MIM 613475
UniProt ID Q96EU6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RRP36 Products

Required fields are marked with *

My Review for All RRP36 Products

Required fields are marked with *

0
cart-icon
0
compare icon