Recombinant Human RSPO2 protein(22-205aa), His-tagged
Cat.No. : | RSPO2-2214H |
Product Overview : | Recombinant Human RSPO2 protein(Q6UXX9)(22-205aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-205aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG |
Gene Name | RSPO2 R-spondin 2 [ Homo sapiens ] |
Official Symbol | RSPO2 |
Synonyms | RSPO2; R-spondin 2; R spondin 2 homolog (Xenopus laevis); R-spondin-2; MGC35555; R-spondin 2 homolog; roof plate-specific spondin-2; CRISTIN2; MGC43342; |
Gene ID | 340419 |
mRNA Refseq | NM_178565 |
Protein Refseq | NP_848660 |
MIM | 610575 |
UniProt ID | Q6UXX9 |
◆ Recombinant Proteins | ||
Rspo2-850M | Active Recombinant Mouse Rspo2 | +Inquiry |
RSPO2-8354Z | Recombinant Zebrafish RSPO2 | +Inquiry |
RSPO2-14553M | Recombinant Mouse RSPO2 Protein | +Inquiry |
RSPO2-4013H | Recombinant Human RSPO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RSPO2-42HCL | Recombinant Human RSPO2 HEK293T cell lysate | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPO2-1645HCL | Recombinant Human RSPO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RSPO2 Products
Required fields are marked with *
My Review for All RSPO2 Products
Required fields are marked with *