Recombinant Human RSPO2 protein(22-205aa), His-tagged
| Cat.No. : | RSPO2-2214H |
| Product Overview : | Recombinant Human RSPO2 protein(Q6UXX9)(22-205aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 22-205aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 22.8 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG |
| Gene Name | RSPO2 R-spondin 2 [ Homo sapiens ] |
| Official Symbol | RSPO2 |
| Synonyms | RSPO2; R-spondin 2; R spondin 2 homolog (Xenopus laevis); R-spondin-2; MGC35555; R-spondin 2 homolog; roof plate-specific spondin-2; CRISTIN2; MGC43342; |
| Gene ID | 340419 |
| mRNA Refseq | NM_178565 |
| Protein Refseq | NP_848660 |
| MIM | 610575 |
| UniProt ID | Q6UXX9 |
| ◆ Recombinant Proteins | ||
| RSPO2-1803HFL | Recombinant Full Length Human RSPO2, Flag-tagged | +Inquiry |
| RSPO2-42HCL | Recombinant Human RSPO2 HEK293T cell lysate | +Inquiry |
| RSPO2-8354Z | Recombinant Zebrafish RSPO2 | +Inquiry |
| RSPO2-480H | Active Recombinant Human RSPO2 Protein, Fc-tagged | +Inquiry |
| RSPO2-14553M | Recombinant Mouse RSPO2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RSPO2-1645HCL | Recombinant Human RSPO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RSPO2 Products
Required fields are marked with *
My Review for All RSPO2 Products
Required fields are marked with *




