Recombinant Human RSU1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RSU1-5733H |
Product Overview : | RSU1 MS Standard C13 and N15-labeled recombinant protein (NP_689937) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors. |
Molecular Mass : | 31.5 kDa |
AA Sequence : | MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RSU1 Ras suppressor protein 1 [ Homo sapiens (human) ] |
Official Symbol | RSU1 |
Synonyms | RSU1; Ras suppressor protein 1; ras suppressor protein 1; FLJ31034; RSP 1; rsu-1; ras suppressor protein 1 variant 1; ras suppressor protein 1 variant 2; ras suppressor protein 1 variant 3; RSP-1; |
Gene ID | 6251 |
mRNA Refseq | NM_152724 |
Protein Refseq | NP_689937 |
MIM | 179555 |
UniProt ID | Q15404 |
◆ Recombinant Proteins | ||
RSU1-4407C | Recombinant Chicken RSU1 | +Inquiry |
Rsu1-5638M | Recombinant Mouse Rsu1 Protein, Myc/DDK-tagged | +Inquiry |
RSU1-2973H | Recombinant Human Ras Suppressor Protein 1, T7-tagged | +Inquiry |
RSU1-5733H | Recombinant Human RSU1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RSU1-30419TH | Recombinant Human RSU1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSU1-2126HCL | Recombinant Human RSU1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RSU1 Products
Required fields are marked with *
My Review for All RSU1 Products
Required fields are marked with *
0
Inquiry Basket