Recombinant Human RSU1
Cat.No. : | RSU1-30419TH |
Product Overview : | Recombinant fragment of Human RSU1 with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR |
Sequence Similarities : | Contains 7 LRR (leucine-rich) repeats. |
Gene Name | RSU1 Ras suppressor protein 1 [ Homo sapiens ] |
Official Symbol | RSU1 |
Synonyms | RSU1; Ras suppressor protein 1; ras suppressor protein 1; FLJ31034; RSP 1; |
Gene ID | 6251 |
mRNA Refseq | NM_012425 |
Protein Refseq | NP_036557 |
MIM | 179555 |
Uniprot ID | Q15404 |
Chromosome Location | 10 |
Pathway | Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-extracellular matrix interactions, organism-specific biosystem; Regulation of cytoskeletal remodeling and cell spreading by IPP complex components, organism-specific biosystem; |
◆ Recombinant Proteins | ||
RSU1-169H | Recombinant Human RSU1, His-tagged | +Inquiry |
RSU1-5733H | Recombinant Human RSU1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RSU1-30419TH | Recombinant Human RSU1 | +Inquiry |
RSU1-4407C | Recombinant Chicken RSU1 | +Inquiry |
RSU1-2973H | Recombinant Human Ras Suppressor Protein 1, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSU1-2126HCL | Recombinant Human RSU1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RSU1 Products
Required fields are marked with *
My Review for All RSU1 Products
Required fields are marked with *
0
Inquiry Basket