Recombinant Human RSU1

Cat.No. : RSU1-30419TH
Product Overview : Recombinant fragment of Human RSU1 with N-terminal proprietary tag. Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
Sequence Similarities : Contains 7 LRR (leucine-rich) repeats.
Gene Name RSU1 Ras suppressor protein 1 [ Homo sapiens ]
Official Symbol RSU1
Synonyms RSU1; Ras suppressor protein 1; ras suppressor protein 1; FLJ31034; RSP 1;
Gene ID 6251
mRNA Refseq NM_012425
Protein Refseq NP_036557
MIM 179555
Uniprot ID Q15404
Chromosome Location 10
Pathway Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-extracellular matrix interactions, organism-specific biosystem; Regulation of cytoskeletal remodeling and cell spreading by IPP complex components, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RSU1 Products

Required fields are marked with *

My Review for All RSU1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon