Recombinant Human RTCA protein(41-350 aa), C-His-tagged
| Cat.No. : | RTCA-2458H |
| Product Overview : | Recombinant Human RTCA protein(O00442)(41-350 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 41-350 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | AGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIRKEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKD |
| ◆ Recombinant Proteins | ||
| RTCA-634C | Recombinant Cynomolgus Monkey RTCA Protein, His (Fc)-Avi-tagged | +Inquiry |
| RTCA-891C | Recombinant Cynomolgus RTCA Protein, His-tagged | +Inquiry |
| RTCA-9941Z | Recombinant Zebrafish RTCA | +Inquiry |
| RTCA-242H | Recombinant Human RTCA, His-tagged | +Inquiry |
| RTCA-2458H | Recombinant Human RTCA protein(41-350 aa), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RTCA-1547HCL | Recombinant Human RTCA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RTCA Products
Required fields are marked with *
My Review for All RTCA Products
Required fields are marked with *



