Recombinant Human RTN4RL2 Protein, His tagged

• Cat.No.: RTN4RL2-001H

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 28-401 aa
• Description: Enables signaling receptor activity. Predicted to be involved in cell surface receptor signaling pathway; corpus callosum development; and negative regulation of neuron projection development. Located in cell surface and plasma membrane.
• Molecular Mass: 43 kDa
• AA Sequence: MAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFRGLSRLTILYLFNNSLASLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 5% Trehalose, 0.1% SKL
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: RTN4RL2 reticulon 4 receptor like 2 [ Homo sapiens (human) ]
• Official Symbol: RTN4RL2
• Synonyms: RTN4RL2; reticulon 4 receptor like 2; NgR2; NGRH1; reticulon-4 receptor-like 2; Nogo-66 receptor homolog 1; nogo receptor-like 3; nogo-66 receptor-related protein 2
• Gene ID: 349667
• mRNA Refseq: NM_178570
• Protein Refseq: NP_848665
• MIM: 610462
• UniProt ID: Q86UN3