Recombinant Human RTN4RL2 Protein, His tagged

Cat.No. : RTN4RL2-001H
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 28-401 aa
Description : Enables signaling receptor activity. Predicted to be involved in cell surface receptor signaling pathway; corpus callosum development; and negative regulation of neuron projection development. Located in cell surface and plasma membrane.
Molecular Mass : 43 kDa
AA Sequence : MAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFRGLSRLTILYLFNNSLASLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 80% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 5% Trehalose, 0.1% SKL
Concentration : 1 mg/mL by BCA
Gene Name RTN4RL2 reticulon 4 receptor like 2 [ Homo sapiens (human) ]
Official Symbol RTN4RL2
Synonyms RTN4RL2; reticulon 4 receptor like 2; NgR2; NGRH1; reticulon-4 receptor-like 2; Nogo-66 receptor homolog 1; nogo receptor-like 3; nogo-66 receptor-related protein 2
Gene ID 349667
mRNA Refseq NM_178570
Protein Refseq NP_848665
MIM 610462
UniProt ID Q86UN3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RTN4RL2 Products

Required fields are marked with *

My Review for All RTN4RL2 Products

Required fields are marked with *

0
cart-icon