Recombinant Human RTN4RL2 Protein, His tagged
Cat.No. : | RTN4RL2-001H |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 28-401 aa |
Description : | Enables signaling receptor activity. Predicted to be involved in cell surface receptor signaling pathway; corpus callosum development; and negative regulation of neuron projection development. Located in cell surface and plasma membrane. |
Molecular Mass : | 43 kDa |
AA Sequence : | MAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFRGLSRLTILYLFNNSLASLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 80% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 5% Trehalose, 0.1% SKL |
Concentration : | 1 mg/mL by BCA |
Gene Name | RTN4RL2 reticulon 4 receptor like 2 [ Homo sapiens (human) ] |
Official Symbol | RTN4RL2 |
Synonyms | RTN4RL2; reticulon 4 receptor like 2; NgR2; NGRH1; reticulon-4 receptor-like 2; Nogo-66 receptor homolog 1; nogo receptor-like 3; nogo-66 receptor-related protein 2 |
Gene ID | 349667 |
mRNA Refseq | NM_178570 |
Protein Refseq | NP_848665 |
MIM | 610462 |
UniProt ID | Q86UN3 |
◆ Recombinant Proteins | ||
RTN4RL2-001H | Recombinant Human RTN4RL2 Protein, His tagged | +Inquiry |
RTN4RL2-2854H | Recombinant Human RTN4RL2 protein, His-tagged | +Inquiry |
RTN4RL2-1832H | Recombinant Human RTN4RL2 protein, GST-tagged | +Inquiry |
RTN4RL2-14574M | Recombinant Mouse RTN4RL2 Protein | +Inquiry |
RTN4RL2-3797H | Recombinant Human RTN4RL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTN4RL2 Products
Required fields are marked with *
My Review for All RTN4RL2 Products
Required fields are marked with *
0
Inquiry Basket